SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8M8T9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8M8T9
Domain Number 1 Region: 94-184
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.06e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 2 Region: 279-353
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.65e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000429
Further Details:      
 
Domain Number 3 Region: 8-82
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.16e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000276
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J8M8T9
Sequence length 361
Comment (tr|A0A2J8M8T9|A0A2J8M8T9_PANTR) PCBP3 isoform 18 {ECO:0000313|EMBL:PNI55927.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0023016 OC=Catarrhini; Hominidae; Pan.
Sequence
MESKVSEGGLNVTLTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISEGNCPERIVT
ITGPTDAIFKAFAMIAYKFEEDIINSMSNSPATSKPPVTLRLVVPASQCGSLIGKGGSKI
KEIRESTGAQVQVAGDMLPNSTERAVTISGTPDAIIQCVKQICVVMLESPPKGATIPYRP
KPASTPVIFAGGQVRADPLAASTANLSLLLQHPPLPAYTIQGQYAIPHPDLTKLHQLAMQ
QTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTIPNDLIGCIIG
RQGTKINEIRQMSGAQIKIANATEGSSERQITITGTPANISLAQYLINARLTSEVTGMGT
L
Download sequence
Identical sequences A0A2J8M8T9 A0A2J8RBW0 E9PFP8 G7MMF6
ENSP00000383159 ENSMMUP00000035727 ENSMMUP00000005096 9544.ENSMMUP00000035727 9598.ENSPTRP00000058412 XP_010368417.1.97406 ENSP00000383159 ENSP00000401198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]