SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8M9X6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8M9X6
Domain Number 1 Region: 74-126
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000392
Family Hairy Orange domain 0.0000529
Further Details:      
 
Domain Number 2 Region: 12-67
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000903
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J8M9X6
Sequence length 186
Comment (tr|A0A2J8M9X6|A0A2J8M9X6_PANTR) HEY1 isoform 5 {ECO:0000313|EMBL:PNI56326.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0022383 OC=Catarrhini; Hominidae; Pan.
Sequence
MSPTTSSQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQGSAKLEKAEILQMTV
DHLKMLHTAGGKGYFDAHALAMDYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHL
NNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGR
LGSAHP
Download sequence
Identical sequences A0A2J8M9X6 A0A2J8V9X2 E5RHK6
ENSP00000429705 ENSP00000429705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]