SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8MKH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8MKH6
Domain Number 1 Region: 1-118
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-28
Family MAM domain 0.00000328
Further Details:      
 
Domain Number 2 Region: 217-311
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000356
Family Fibronectin type III 0.0059
Further Details:      
 
Domain Number 3 Region: 121-224
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000154
Family I set domains 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J8MKH6
Sequence length 313
Comment (tr|A0A2J8MKH6|A0A2J8MKH6_PANTR) PTPRT isoform 10 {ECO:0000313|EMBL:PNI60025.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0020081 OC=Catarrhini; Hominidae; Pan.
Sequence
GSFMMVNSSGRASGQKAHLLLPTLKENDTHCIDFHYYFSSRDRSSPGALNVYVKVNGGPQ
GNPVWNVSGVVTEGWVKAELAISTFWPHFYQVIFESVSLKGHPGYIAVDEVRVLAHPCRK
APHFLRLQNVEVNVGQNATFQCIAGGKWSQHDKLWLQQWNGRDTALMVTRVVNHRRFSAT
VSVADTAQRSVSKYRCVIRSDGGSGVSNYAELIVKEPPTPIAPPELLAVGATYLWIKPNA
NSIIGDGPIILKEVEYRTTTGTWAETHIVDSPNYKLWHLDPDVEYEIRVLLTRPGEGGTG
PPGPPLTTRTKCA
Download sequence
Identical sequences A0A087WWD6 A0A2J8MKH6
ENSP00000480136 9544.ENSMMUP00000037946 ENSMMUP00000037946 ENSMMUP00000037946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]