SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8MMF6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8MMF6
Domain Number 1 Region: 40-164
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000275
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J8MMF6
Sequence length 265
Comment (tr|A0A2J8MMF6|A0A2J8MMF6_PANTR) TPGS2 isoform 12 {ECO:0000313|EMBL:PNI60687.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0019449 OC=Catarrhini; Hominidae; Pan.
Sequence
MEEEASSPGLGCSKPHLEKLTLGITRILESSPGVTEVTIIEKPPAERHMISSWEQKNNCV
MPEDVKNFYLMTNGFHMTWSVKLDDLEDDTHEASDDQPEKPHFDSRSVIFELDSCNGSGK
VCLVYKSGKPALAEDTEIWFLDRALYWHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGIS
PQAKQWFSMYKPITYNTNLLTEETDSFVNKLDPSKVFKSKNKIVIPKKKGPVQPAGGQKG
PSGPSGPSTSSTSKSSSGSGNPTRK
Download sequence
Identical sequences A0A2J8MMF6
ENSP00000467392 ENSP00000467392 NP_001258878.1.87134 NP_001258878.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]