SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8MNL0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8MNL0
Domain Number 1 Region: 3-128
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.8e-23
Family Pyridoxal-dependent decarboxylase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8MNL0
Sequence length 129
Comment (tr|A0A2J8MNL0|A0A2J8MNL0_PANTR) GAD2 isoform 3 {ECO:0000313|EMBL:PNI61077.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0018915 OC=Catarrhini; Hominidae; Pan.
Sequence
MNILLQYVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILMHCQTTLKYAIKTG
HPRYFNQLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGS
GDGIFSPGT
Download sequence
Identical sequences A0A2J8MNL0 A0A2J8SUR0 A0A2K5YHP4 A0A2K6NS18 Q5VZ29
ENSP00000365424 ENSP00000365424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]