SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8N0T9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8N0T9
Domain Number 1 Region: 51-366
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.65e-98
Family Glycosyl hydrolases family 35 catalytic domain 0.0000651
Further Details:      
 
Domain Number 2 Region: 484-620
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.66e-27
Family Beta-galactosidase LacA, domains 4 and 5 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J8N0T9
Sequence length 636
Comment (tr|A0A2J8N0T9|A0A2J8N0T9_PANTR) GLB1L2 isoform 3 {ECO:0000313|EMBL:PNI65388.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0015362 OC=Catarrhini; Hominidae; Pan.
Sequence
MTTWSLRRRPARTLGLLLLVVLGFLVLRRLDWSTLVPLRLRHRQLGLQAKGWNFVLEGST
FWIFGGSIHYFRVPREYWRDRLLKMKACGLNTLTTYVPWNLHEPERSKFDFSGNLDLEAF
VLMAAEIGLWVILRPGPYICSEMDLGGLPSWLLQDPGMRLRTTYKGFTEAVDLYFDHLMS
RVVPLQYKRGGPIIAVQVENEYGSYNKDPAYMPYVKKALEDRGIVELLLTSDNKDGLSKG
IVQGVLATINLQSTHELQLLTTFLFNVQGTQPKMVMEYWTGWFDSWGGPHNILDSSEVLK
TVSAIVDAGSSINLYMFHGGTNFGFMNGAMHFHDYKSDVTSYDYDAVLTEAGDYTAKYMK
LRDFFGSISGIPLPPPPDLLPKMPYEPVTPVLYLSLWDALKYLGEPIKSEKPINMENLPV
NGGNGQSFGYVLYETGITSPGILSGRVHDRGQVFVNTVSIGFLDYKTTKIALPLIQGYTV
LRILVENRGRVNYGENIDDQRKGLIGNLYLNDSPLKNFRIYSLDMKKSFFQRFGLDKWSS
LPETPTLPAFFLGSLSISSTPCDTFLKLEGWEKGVVFINGQNLGRYWNIGPQKTLYLPGP
WLSSGINQVIIFEETMAGPALQFTETPHLGRNQYIK
Download sequence
Identical sequences A0A2J8N0T9
9598.ENSPTRP00000007693 ENSPTRP00000007693 ENSPTRP00000007693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]