SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8P5D2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8P5D2
Domain Number 1 Region: 72-129
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.88e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J8P5D2
Sequence length 135
Comment (tr|A0A2J8P5D2|A0A2J8P5D2_PANTR) ARNTL isoform 14 {ECO:0000313|EMBL:PNI79227.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0005730 OC=Catarrhini; Hominidae; Pan.
Sequence
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGR
LEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQ
HMKTLRGATNPYTEA
Download sequence
Identical sequences A0A2J8P5D2 A0A2J8UQ52 E9PKF0
ENSP00000433571 ENSP00000433571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]