SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2J8PDA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8PDA2
Domain Number 1 Region: 25-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.93e-19
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8PDA2
Sequence length 202
Comment (tr|A0A2J8PDA2|A0A2J8PDA2_PANTR) MRPL43 isoform 7 {ECO:0000313|EMBL:PNI82001.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0004121 OC=Catarrhini; Hominidae; Pan.
Sequence
MTARGTPSRFLASVLHNGLGRYVQQLQRLSFSVSRDGASSRGAREFVEREVIDFARRNPG
VVIYVNSRPCCVPRVVAEYLNGAVREESIHCKSVEEISTLVQKLADQSGLDVIRIRKPFH
TDNPSIQGQWHPFTNKPTTFRGLRPREVQDPAPAQDTGLRLSAVAPQILLPGWPDPISVQ
SSDLPWGNTHYRPEPLSSTTWL
Download sequence
Identical sequences A0A2J8PDA2
gi|28872736|ref|NP_789763.1| ENSP00000299179 ENSP00000299179 NP_789763.1.87134 NP_789763.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]