SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8PGU2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8PGU2
Domain Number 1 Region: 2-97
Classification Level Classification E-value
Superfamily UBC-like 2.68e-20
Family UBC-related 0.0000205
Further Details:      
 
Domain Number 2 Region: 96-123
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000042
Family UBA domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J8PGU2
Sequence length 123
Comment (tr|A0A2J8PGU2|A0A2J8PGU2_PANTR) UBE2K isoform 7 {ECO:0000313|EMBL:PNI83230.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0003741 OC=Catarrhini; Hominidae; Pan.
Sequence
MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEI
KIPETYPFNPPKYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIV
ALS
Download sequence
Identical sequences A0A2J8PGU2 A0A2J8TCU0 D6RDM7
ENSP00000425301 ENSP00000425301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]