SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8QSK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8QSK3
Domain Number 1 Region: 13-52
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000404
Family Ankyrin repeat 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J8QSK3
Sequence length 116
Comment (tr|A0A2J8QSK3|A0A2J8QSK3_PANTR) CDKN2A isoform 8 {ECO:0000313|EMBL:PNI99249.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0014549 OC=Catarrhini; Hominidae; Pan.
Sequence
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVGRGSAAGAG
DGGRLWRTKFAGELESGSASILRKKGRLPGEFSEGVCNHRPPPGDALGAWEAKEEE
Download sequence
Identical sequences A0A2J8QSK3 G3XAG3
NP_478104.2.87134 NP_478104.2.92137 ENSP00000369496 gi|98985804|ref|NP_478104.2| ENSP00000369496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]