SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8QV05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8QV05
Domain Number 1 Region: 57-92
Classification Level Classification E-value
Superfamily MOSC N-terminal domain-like 0.0000115
Family MOSC N-terminal domain-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8QV05
Sequence length 94
Comment (tr|A0A2J8QV05|A0A2J8QV05_PANTR) MARC2 isoform 6 {ECO:0000313|EMBL:PNJ00103.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0012579 OC=Catarrhini; Hominidae; Pan.
Sequence
MGASSSSALARLGLPARPWPRWLGVAALGLAAVALGTVAWRRAWPRRRRRLQQVGTVAKL
WIYPVKSCKGVPVSEAECTAMGLRSGNLRDRMCA
Download sequence
Identical sequences A0A2J8QV05 F6V6Z1
ENSP00000435450 ENSP00000435450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]