SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8R1W3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2J8R1W3
Domain Number - Region: 6-36
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 0.000175
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8R1W3
Sequence length 37
Comment (tr|A0A2J8R1W3|A0A2J8R1W3_PONAB) RRM1 isoform 2 {ECO:0000313|EMBL:PNJ02502.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0054770 OC=Catarrhini; Hominidae; Pongo.
Sequence
MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPM
Download sequence
Identical sequences A0A2J8ITU7 A0A2J8R1W3 E9PRY9
ENSP00000434069 ENSP00000434069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]