SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8RHN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8RHN5
Domain Number 1 Region: 72-135
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 5.5e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8RHN5
Sequence length 201
Comment (tr|A0A2J8RHN5|A0A2J8RHN5_PONAB) SCX isoform 1 {ECO:0000313|EMBL:PNJ08036.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0050856 OC=Catarrhini; Hominidae; Pongo.
Sequence
MSFATLRPAPPGRYLYPEVSPLSEDEDRGSDSSGSDEKPCRVHAARCGLQGARRRAGGRR
AGGGGPGGRPGREPRQRHTANARERDRTNSVNTAFTALRTLIPTEPADRKLSKIETLRLA
SSYISHLGNVLLAGEACGDGQPCHSGPAFFHAARAGSPPPPPPPPPARDGENTQPKQICT
FCLSNQRKLSKDRDRKTAIRS
Download sequence
Identical sequences A0A096NFP0 A0A0D9R8G4 A0A2J8RHN5 A0A2K5KID7 Q7RTU7
ENSP00000476384 gi|148922889|ref|NP_001073983.1| gi|186972126|ref|NP_001008272.1| ENSP00000342868 ENSP00000345599 9606.ENSP00000342868 9606.ENSP00000345599 ENSP00000342868 ENSP00000345599 ENSP00000476384 NP_001073983.1.92137 XP_006716679.1.92137 XP_008000096.1.81039 XP_008000097.1.81039 XP_011905587.1.92194 XP_011905588.1.92194 XP_011905589.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]