SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8RR73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8RR73
Domain Number 1 Region: 487-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.17e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 431-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-24
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 3 Region: 319-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.6e-23
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.15e-22
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 5 Region: 375-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.98e-21
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 6 Region: 262-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-19
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 532-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.18e-19
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 8 Region: 130-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000258
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J8RR73
Sequence length 632
Comment (tr|A0A2J8RR73|A0A2J8RR73_PONAB) ZNF792 isoform 1 {ECO:0000313|EMBL:PNJ10995.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0049085 OC=Catarrhini; Hominidae; Pongo.
Sequence
MAAAALRDPAQGCVTFEDVTIYFSQEEWVLLDEAQRLLYCDVMLENFALIASLGLISFRS
HIVSQLEMGKEPWVPDSVDMTSAMARGAYGRPGSDFCHGTEGKDLPSEHNVSVEGVAQDR
SPEATLCPQKTCPCDICGLRLKDILHLAEHQTTHPRQKPFVCEAYVKASEFSANLPQKRV
QQNVHNPIRREEGQASPVKTCGDYTSDQLSTCREGGKDFVATAGFLQHEITPSNGEPHKA
TEGVVDFHIALRHNKCCESRDAFNDKSTLVQHQRIHSRERPYECSKCGIFFSYAADLTQH
QKVHNRGKPYECCECGKFFSQHSSLVKHRRVHTGESPHVCGDCGKFFSRSSNLIQHKRVH
TGEKPYECSDCGKFFSQRSNLIHHKRVHTGRSAHECSECGKSFNCNSSLIKHWRVHTGER
PYKCNECGKFFSHIASLIQHQIVHTGERPHGCGECGKAFSRSSDLMKHQRVHTGERPYEC
NECGKLFSQSSSLNSHRRLHTGERPYQCSECGKFFNQSSSLNNHRRLHTGERPYECSECG
KTFRQRSNLRQHLKVHKPDRPYECSECGKAFNQRPTLIRHQKIHTRERSMENVLLPCSQH
TPEISSENRSYEGVVNYKLKLVYPSTHPGEVP
Download sequence
Identical sequences A0A2J8RR73

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]