SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8TGR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8TGR5
Domain Number 1 Region: 737-787
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000114
Family Laminin-type module 0.005
Further Details:      
 
Domain Number 2 Region: 582-630
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000558
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 3 Region: 689-739
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000949
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 4 Region: 247-286
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000012
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 5 Region: 628-680
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000142
Family Laminin-type module 0.0075
Further Details:      
 
Domain Number 6 Region: 124-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000452
Family Laminin-type module 0.052
Further Details:      
 
Domain Number 7 Region: 534-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000173
Family Laminin-type module 0.0046
Further Details:      
 
Domain Number 8 Region: 789-843
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000193
Family Laminin-type module 0.0024
Further Details:      
 
Domain Number 9 Region: 894-942
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000586
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 10 Region: 846-889
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000753
Family Laminin-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8TGR5
Sequence length 1549
Comment (tr|A0A2J8TGR5|A0A2J8TGR5_PONAB) LAMB2 isoform 5 {ECO:0000313|EMBL:PNJ32134.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0035014 OC=Catarrhini; Hominidae; Pongo.
Sequence
MLVERSADFGRTWHVYRYFSYDCGADFPGVPLAPPRHWDDVVCESRYSEIEPSTEGEVIY
RVLDPAIPVPDPYSSRIQNLLKITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVV
RGNCFCYGHASECAPAPGAPAHAEGMVHGACICKHNTRGLNCEQCQDFYHDLPWHPAEDG
YSHACRKCECHGHTHSCHFDMAVYLASGNPNMSTATVSQSADGSPSLQDVNPGHWGLSHD
LLGCRPCDCDVGGALDPQCDEATGQCHCRQHMVGRRCEQVQPGYFRPFLDHLIWEAEDTR
GQVLDVVERLVTLGETPSWTGSGFVRLQEGQTLEFLVASVPKAMDYDLLLRLEPQVPEQW
AELELIVQRPGPVPAHSLCGHLVAKDDRIQGTLQPHARMLVARPCWAWLCSQKGSRQIKA
CSLRYMMFPNPVCLEPGISYKLHLKLVRTGGSAQPETPYSGPGLLIDSLVLLPHVLVLEM
FSGGDAAALERRATFERYQCHEEGLVPSKTSPSEACAPLLISLSTLIYNGALPCQCNPQG
SLSSECNPHGGQCLCKPGVVGRCCDLCASGYYGFGPTGCQACQCSHEGALSSLCEKTSGQ
CPCRTGAFGLRCDRCQRGQWGFPSCRPCVCNGHADECNTHTGACLGCRDHTGGEHCERCI
AGFHGDPRLPYGGQCRPCPCPEGPGSQRHFATSCHRDEYSQQIVCHCRAGYTGLRCEACA
PGHFGDPSRPGGRCQLCECSGNIDPMDPDACDPHTGQCLRCLHHTEGPHCAHCKPGFHGQ
AARQSCHRCTCNLLGTNPQQCPSPDQCHCDPSSGQCPCLPNVQGPSCDRCAPNFWNLTSG
HGCQPCACHPSRARGPTCNEFTGQCHCRAGFGGRTCSECQELHWGDPGLQCRACDCDSRG
IDTPQCHRSTGHCSCRPGVSGVRCDQCARGFSGIFPACHPCHACFGDWDRVVQDLAARTR
RLEQRAQELQQTGVLGAFESSFWHMQEKLGIVQGIVGARNTSAASTAQLVEATEELRREI
GEATEHLTQLEAELTDVQDENFNANHALSGLERDRIALNLTLRQLHQHLDLLKHSNFLGA
YDSIRHAHRQSAEAERRANTSALAVPSPVSNSASARHRTEALMDAQKEDFNSKHMANQRA
LGKLSAHTHTLSLTDINELVCGAPGDAPCATSPCGGASCRDEDGQPRCGGLSCNGAAATA
DLALGRARHTQAELQRALAEGGSILSRVAETRRQASEAQQRAQAALDKANASRGQVEQAN
QELRELIQSVKDFLNQEGADPDSIEMVATRVLELSIPASAEQIQHLASAIAERVRSLADV
DAILARTVGDVRRAEQLLQDARRARSRAEDEKQKAETVQEALEEAQRAQGVAQGAIRGAV
ADTQDTEQTLYQVQERMAGAEQALSSAGERARQLDALLEALKLKRAGNSLAASTAEETAG
SAQGRAQEAEQLLRGPLGDQYQTVKALAERKAQGVLAAQARAEQLRDEARDLLQAAQDKL
QRLQELEGTYEENERALESKAAQLDGLEARMRSVLQAINLQVQIYNTCQ
Download sequence
Identical sequences A0A2J8TGR5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]