SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8TNT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8TNT3
Domain Number 1 Region: 179-416
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 0.0000000942
Family Glycerol-3-phosphate (1)-acyltransferase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J8TNT3
Sequence length 456
Comment (tr|A0A2J8TNT3|A0A2J8TNT3_PONAB) GPAT4 isoform 1 {ECO:0000313|EMBL:PNJ34697.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0033313 OC=Catarrhini; Hominidae; Pongo.
Sequence
MFLLLPFDSLIVNLLGISLTVLFTLLLVFIIVPAIFGVSFGIRKLYMKTLLKIFAWATLR
MERGAKEKNHQLYKPYTNGIIAKDPTSLEEEIKEIRRSGSSKALDNTPEFELSDIFYFCR
KGMETIMDDEVTKRFSAEELESWNLLSRTNYNFQYISLRLTVLWGLGVLIRYCFLLPLRI
ALAFTGISLLVVGTTVVGYLPNGRFKEFMSKHVHLMCYRICVRALTAIITYHDRENRPRN
GGICVANHTSPIDVIILASDGYYAMVGQVHGGLMGVIQRAMVKACPHVWFERSEVKDRHL
VAKRLTEHVQDKSKLPILIFPEGTCINNTSVMMFKKGSFEIGATVYPVAIKYDPQFGDAF
WNSSKYGMVTYLLRMMTSWAIVCSVWYLPPMTREADEDAVQFANRVKSAIARQGGLVDLL
WDGGLKREKVKDTFKEEQQKLYSKMIVGNHKDRSRS
Download sequence
Identical sequences A0A2I3GTI6 A0A2J8TNT3 G3RIX8 K7DNJ8 Q5R6J7
ENSPPYP00000020792 ENSGGOP00000015645 9598.ENSPTRP00000034579 ENSPPYP00000020792 XP_001138888.1.37143 XP_003269672.1.23891 XP_003823348.1.60992 XP_004046992.1.27298 XP_008975180.1.60992 XP_008975181.1.60992 XP_009242025.1.23681 XP_016814877.1.37143 XP_018887982.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]