SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8TW45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8TW45
Domain Number 1 Region: 358-482
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.93e-17
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 2 Region: 444-562
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000157
Family Growth factor receptor domain 0.023
Further Details:      
 
Domain Number 3 Region: 183-238
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000508
Family EGF-type module 0.017
Further Details:      
 
Domain Number 4 Region: 306-364
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000226
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 5 Region: 256-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000367
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J8TW45
Sequence length 711
Comment (tr|A0A2J8TW45|A0A2J8TW45_PONAB) FBLN1 isoform 3 {ECO:0000313|EMBL:PNJ37247.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0031817 OC=Catarrhini; Hominidae; Pongo.
Sequence
MERAAPSRRVPLPLLLLGGLALLAAGVDADVLLEACCADGHRMATHQKDCSLPYATESKE
CRMVQEQCCHSQLEELHCATGISLANEQDHCATPHGDNASLEATFVKRCCHCCLLGRAAQ
AQGQSCEYSLMVGYQCGQVFRACCVKSQETGDLDVGGLQETDKIIEVEEEQEDPYLNDRC
RGGGPCKQQCRDTGDEVVCSCFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSF
RCQRDSSCGTGYELTEDNSCKDIDECESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQ
DALGNCIDINECLSISAPCPIGHTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDEC
APPAEPCGKGHRCVNSPGSFRCECKTGYYFDGISRMCVDVNECQRYPGRLCGHKCENTLG
SYLCSCSVGFRLSADGRSCEDINECSSSPCSQECANVYGSYQCYCRRGYQLSDVDGVTCE
DIDECALPTGGHICSYRCINIPGSFQCSCPSSGYRLAPNGRNCQDIDECVTGIHNCSINE
TCFNIQGGFRCLAFECPENYRRSAATQKSKKERQNTPAGSSKEDCRFLHGSRGWGIPTLM
PSEEDGPGQTVSPTPRTEQLLQQEKTDTIRCIKSCRPNDVTCVFDPVHTISHTVISLPTF
REFTRPEEIIFLRAITPPHPASQANIIFDITEGNLRDSFDIIKRYMDGMTV
Download sequence
Identical sequences A0A2J8TW45

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]