SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8TWR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8TWR9
Domain Number 1 Region: 36-88
Classification Level Classification E-value
Superfamily RNI-like 0.0000173
Family Rna1p (RanGAP1), N-terminal domain 0.0053
Further Details:      
 
Weak hits

Sequence:  A0A2J8TWR9
Domain Number - Region: 5-48
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 0.0361
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J8TWR9
Sequence length 100
Comment (tr|A0A2J8TWR9|A0A2J8TWR9_PONAB) RANGAP1 isoform 5 {ECO:0000313|EMBL:PNJ37477.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0031952 OC=Catarrhini; Hominidae; Pongo.
Sequence
MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEGNT
VGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPAL
Download sequence
Identical sequences A0A2J8LN64 A0A2J8TWR9 B0QYT5
ENSP00000408743 ENSP00000408743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]