SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8UD60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8UD60
Domain Number 1 Region: 67-110
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000799
Family UBA domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8UD60
Sequence length 114
Comment (tr|A0A2J8UD60|A0A2J8UD60_PONAB) UBL7 isoform 2 {ECO:0000313|EMBL:PNJ43212.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0028800 OC=Catarrhini; Hominidae; Pongo.
Sequence
PASLGYSGAAGPRPITQSELATALALASTPESSSHTPTPGTQSGTPITNDLFSQALQHAL
QASGQPSLQSQWQPQLQQLRDMGIQDDELSLRALQATGGDIQAALELIFAGGAP
Download sequence
Identical sequences A0A2J8KRR4 A0A2J8UD60 F7EMI6 H3BSE0
ENSP00000456662 ENSP00000456662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]