SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8UET5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8UET5
Domain Number 1 Region: 553-620
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000144
Family HLH, helix-loop-helix DNA-binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8UET5
Sequence length 664
Comment (tr|A0A2J8UET5|A0A2J8UET5_PONAB) TCF4 isoform 34 {ECO:0000313|EMBL:PNJ43792.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0028437 OC=Catarrhini; Hominidae; Pongo.
Sequence
MQRAKTELFRLQIVTDDLRKNEMFSPPVSSGKNGPTSLASGHFTGSNVEDRSSSGSWGNG
GHPSPSRNYGDGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQGCH
QQSLLGGDMDMGNPGTLSPTKPGSQYYQYSSNNPRRRPLHSSAMEVQTKKVRKVPPGLPS
SVYAPSASTADYNRDSPGYPSSKPATSTFPSSFFMQDGHHSSDPWSSSSGMNQPGYAGML
GNSSHIPQSSSYCSLHPHERLSYPSHSSADINSSLPPMSTFHRSGTNHYSTSSCTPPANG
TDSIMANRGSGAAGSSQTGDALGKALASIYSPDHTNNSFSSNPSTPVGSPPSLSGTAVWS
RNGGQASSSPNYEGPLHSLQSRIEDRLERLDDAIHVLRNHAVGPSTAMPGGHGDMHGIIG
PSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSAT
SPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKDIKS
ITSNNDDEDLTPEQKAEREKERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTK
LLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSEPPPLSLAGPHPGMGDASNH
MGQM
Download sequence
Identical sequences A0A2I3GES3 A0A2I3N2S0 A0A2J8UET5 A0A2K5HDG6 A0A2K5NQP6 A0A2K5W409 A0A2K5XN87 A0A2K6DUJ7 A0A2K6MS12 A0A2K6QNK0 F7H0C9 G3RJL0
NP_001230159.1.87134 NP_001230159.1.92137 XP_003827289.1.60992 XP_004087757.1.23891 XP_011804510.1.43180 XP_011827110.1.47321 ENSP00000455418 ENSP00000455418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]