SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8UGX7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8UGX7
Domain Number 1 Region: 158-219
Classification Level Classification E-value
Superfamily RING/U-box 1.2e-16
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Weak hits

Sequence:  A0A2J8UGX7
Domain Number - Region: 142-153
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0241
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8UGX7
Sequence length 350
Comment (tr|A0A2J8UGX7|A0A2J8UGX7_PONAB) DTX3 isoform 1 {ECO:0000313|EMBL:PNJ44536.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0027751 OC=Catarrhini; Hominidae; Pongo.
Sequence
MPILSSSGSKMAACGGTCKNKVTVSKPVWDFLSKETPARLARLREEHRVSILIDGETSDI
YVLQLSPQGPPPAPPNGLYLARKALKGLLKEAEKELKKAQRQGELMGCLALGGGGEHPEM
HRAGPPPLRAAPLLPPGARGLPPPPPPLPPPLPPRLREEAEEQESTCPICLGEIQNAKTL
EKCRHSFCEGCITRALQVKKACPMCGRFYGQLVGNQPQNGRMLVSKDATLLLPSYEKYGT
IVIQYVFPPGVQGAEHPNPGVRYPGTTRVAYLPDCPEGNKVLTLFRKAFDQRLTFTIGTS
MTTGRPNVITWNDIHHKTSCTGGPQLFGYPDPTYLTRVQEELRAKGITDD
Download sequence
Identical sequences A0A096MZI1 A0A2J8KW03 A0A2J8UGX7 A0A2K5LPM4 A0A2K5TM11 A0A2K6B0F5 A0A2K6RBT4
ENSGGOP00000003103 ENSP00000338050 ENSP00000448696 NP_001273174.1.87134 NP_001273174.1.92137 XP_005268754.1.92137 XP_005268755.1.92137 XP_005268757.1.92137 XP_005571420.1.63531 XP_008002013.1.81039 XP_010387246.1.97406 XP_010387247.1.97406 XP_010387249.1.97406 XP_011726721.1.29376 XP_011781398.1.43180 XP_011781399.1.43180 XP_011843975.1.47321 XP_011843976.1.47321 XP_011918661.1.92194 XP_011918662.1.92194 XP_011918663.1.92194 XP_011918664.1.92194 XP_015007619.1.72884 XP_015007620.1.72884 XP_015286608.1.63531 XP_016778646.1.37143 XP_016778647.1.37143 XP_018894941.1.27298 ENSP00000448696 ENSGGOP00000003103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]