SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8VA89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8VA89
Domain Number 1 Region: 74-121
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000102
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 2 Region: 35-76
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000301
Family Somatomedin B domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J8VA89
Sequence length 264
Comment (tr|A0A2J8VA89|A0A2J8VA89_PONAB) SBSPON isoform 2 {ECO:0000313|EMBL:PNJ54417.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0020709 OC=Catarrhini; Hominidae; Pongo.
Sequence
MRILWMALCALARLWPGAQAGCAEAGRCCPGRDPACFARGWRLDRVYGTCFCDQTCRLTG
DCCFDYDRACPARPCFVGEWSPWSGCADQCKPTTRVRRRSVQQEPQNGGAPCPPLEERAG
CLEYSTPQGQGCGHSYVPAFITTSAFNKERTRQATSPHWSTHTEDAGYCMEFKTESLTPH
CALENRPLTRWMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRC
QGTWKKVRRVDQCSCPAVHSFIFI
Download sequence
Identical sequences A0A2J8VA89
XP_002819224.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]