SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8VI74 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8VI74
Domain Number 1 Region: 1-35
Classification Level Classification E-value
Superfamily UBA-like 0.00000000357
Family TAP-C domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J8VI74
Sequence length 35
Comment (tr|A0A2J8VI74|A0A2J8VI74_PONAB) NSFL1C isoform 6 {ECO:0000313|EMBL:PNJ57222.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0018446 OC=Catarrhini; Hominidae; Pongo.
Sequence
MAAERQEALREFVAVTGAEEDRARFFLESAGWDLQ
Download sequence
Identical sequences A0A2J8MS08 A0A2J8VI74 G3V4V8
ENSP00000451675 ENSP00000452019 ENSP00000451675 ENSP00000452019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]