SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8VKM9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8VKM9
Domain Number 1 Region: 48-172
Classification Level Classification E-value
Superfamily SET domain 6.8e-40
Family Histone lysine methyltransferases 0.00079
Further Details:      
 
Weak hits

Sequence:  A0A2J8VKM9
Domain Number - Region: 4-52
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 0.0353
Family Tryptophan biosynthesis enzymes 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8VKM9
Sequence length 175
Comment (tr|A0A2J8VKM9|A0A2J8VKM9_PONAB) SUV39H2 isoform 8 {ECO:0000313|EMBL:PNJ58067.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0018336 OC=Catarrhini; Hominidae; Pongo.
Sequence
WCVPCLVSLDTLQELCRKEKLTCKSIGITKRNLNNYEVEYLCDYKVVKVITSEEAERRGQ
FYDNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIA
LFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN
Download sequence
Identical sequences A0A2J8QJH2 A0A2J8VKM9
ENSMMUP00000004700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]