SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8WG14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8WG14
Domain Number 1 Region: 275-403
Classification Level Classification E-value
Superfamily ApaG-like 7.19e-41
Family ApaG-like 0.00021
Further Details:      
 
Domain Number 2 Region: 94-260
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 8.37e-22
Family SMI1/KNR4-like 0.0079
Further Details:      
 
Domain Number 3 Region: 4-76
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000017
Family F-box domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8WG14
Sequence length 410
Comment (tr|A0A2J8WG14|A0A2J8WG14_PONAB) FBXO3 isoform 4 {ECO:0000313|EMBL:PNJ68723.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0011114 OC=Catarrhini; Hominidae; Pongo.
Sequence
MAAMETETAPLTLESLPTDPLLLILSFLDYRDLINRRLSQLSSHDPLWRRHCKKYWLISE
EEKTQKNQCWKSLFIDTYSDVGRYIDHYAAIKKAWDDLKKYLEPRCPRMVLSLKEGAREE
DLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTAAGGFQ
QRQGLKYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQMARNPAAIDMFIIGATF
TDWFTSYVKNVVSGGFPIIRDQIFRYVHDPECVATTGDITVSVSTSFLPELSSVHPPHYF
FTYRIRIEMSKDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVGEFPIISPGRVYEYTS
CTTFSTTSGYMEGYYTFHFLYFKDKIFNVAIPRFHMACPTFRVSIARLVS
Download sequence
Identical sequences A0A2J8P420 A0A2J8WG14
ENSP00000433781 ENSP00000433781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]