SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8WG41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8WG41
Domain Number 1 Region: 280-408
Classification Level Classification E-value
Superfamily ApaG-like 7.32e-41
Family ApaG-like 0.00021
Further Details:      
 
Domain Number 2 Region: 99-265
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 8.63e-22
Family SMI1/KNR4-like 0.0079
Further Details:      
 
Domain Number 3 Region: 4-81
Classification Level Classification E-value
Superfamily F-box domain 2.22e-18
Family F-box domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J8WG41
Sequence length 415
Comment (tr|A0A2J8WG41|A0A2J8WG41_PONAB) FBXO3 isoform 1 {ECO:0000313|EMBL:PNJ68721.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0011114 OC=Catarrhini; Hominidae; Pongo.
Sequence
MAAMETETAPLTLESLPTDPLLLILSFLDYRDLINCCYVSRRLSQLSSHDPLWRRHCKKY
WLISEEEKTQKNQCWKSLFIDTYSDVGRYIDHYAAIKKAWDDLKKYLEPRCPRMVLSLKE
GAREEDLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTA
AGGFQQRQGLKYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQMARNPAAIDMFI
IGATFTDWFTSYVKNVVSGGFPIIRDQIFRYVHDPECVATTGDITVSVSTSFLPELSSVH
PPHYFFTYRIRIEMSKDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVGEFPIISPGRV
YEYTSCTTFSTTSGYMEGYYTFHFLYFKDKIFNVAIPRFHMACPTFRVSIARLVS
Download sequence
Identical sequences A0A2J8WG41 K7B6X1
ENSP00000408836 NP_208385.1.87134 NP_208385.1.92137 gi|15812188|ref|NP_208385.1| ENSP00000408836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]