SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8WMB0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8WMB0
Domain Number 1 Region: 3-141
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.39e-41
Family Dual specificity phosphatase-like 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8WMB0
Sequence length 205
Comment (tr|A0A2J8WMB0|A0A2J8WMB0_PONAB) DUSP22 isoform 7 {ECO:0000313|EMBL:PNJ70914.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0009170 OC=Catarrhini; Hominidae; Pongo.
Sequence
MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPS
QNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRA
GRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILGKYKEQGRMEP
QPGARRWSSFPALAPLAYDNYTTET
Download sequence
Identical sequences A0A2I3HQW8 A0A2J8WMB0 A0A2K5HW18 A0A2K6JYN2 A0A2K6QUS0
ENSNLEP00000012912 XP_009239660.1.23681 XP_010372485.1.97406 XP_011810522.1.43180 XP_012364639.1.23891 XP_017707344.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]