SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8X445 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8X445
Domain Number 1 Region: 39-205
Classification Level Classification E-value
Superfamily Sec7 domain 6.41e-58
Family Sec7 domain 0.0000512
Further Details:      
 
Domain Number 2 Region: 251-386
Classification Level Classification E-value
Superfamily PH domain-like 6.43e-29
Family Pleckstrin-homology domain (PH domain) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8X445
Sequence length 513
Comment (tr|A0A2J8X445|A0A2J8X445_PONAB) PSD3 isoform 5 {ECO:0000313|EMBL:PNJ76812.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0005061 OC=Catarrhini; Hominidae; Pongo.
Sequence
MGSSWCLYGCCNAGVKTTRLEAHSEMGSTEILEKETPENLSNGTSSNVEAAKRLAKRLYQ
LDRFKRSDVAKHLGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRYFFKAFSLVGETQERER
VLIHFSNRYFYCNPDTIASQDGVHCLTCAIMLLNTDLHGHNIGKKMTCQEFIANLQGVNE
GVDFSKDLLKALYNSIKNEKLEWAVDDEEKKKSPSESTEEKANGTHPKTISRIGSTTNPF
LDIPHDPNAAVYKSGFLARKIHADMDGKKTPRGKRGWKTFYAVLKGTVLYLQKDEYKPEK
ALSEEDLKNAVSVHHALASKATDYEKKPNVFKLKTADWRVLLFQTQSPEEMQGWINKINC
VAAVFSAPPFPAAIGSQKKFSRPLLPATTTKLSQEEQLKSHESKLKQITTELAEHRSYPP
DKKVKAKDVDEYKLKDHYLEFEKTRYEMYVSILKEGGKELLSNDESEAAGLKKSHSSPSL
NPDTSPITAKVKRNVSERKDHRPETPSIKQKVT
Download sequence
Identical sequences A0A2J8X445
ENSP00000286485 ENSP00000286485 gi|45827716|ref|NP_996792.1| NP_996792.1.87134 NP_996792.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]