SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2J8XW14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8XW14
Domain Number 1 Region: 40-130
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.07e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.0069
Further Details:      
 
Domain Number 2 Region: 217-317
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000000000487
Family Glutathione S-transferase (GST), C-terminal domain 0.0067
Further Details:      
 
Weak hits

Sequence:  A0A2J8XW14
Domain Number - Region: 177-211
Classification Level Classification E-value
Superfamily SARS Nsp1-like 0.0314
Family SARS Nsp1-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8XW14
Sequence length 367
Comment (tr|A0A2J8XW14|A0A2J8XW14_PONAB) GDAP1L1 isoform 4 {ECO:0000313|EMBL:PNJ86203.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0038449 OC=Catarrhini; Hominidae; Pongo.
Sequence
MATPNNLTPTNCSWWPISALESDAAKPAEAPDAPEAASPAHWPRESLVLYHWTQSFSSQK
VRLVIAEKGLVCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVER
TFTGEHVVALMPEVGSLQHARVLQYRELLDALPMDAYTHGCILHPELTTDSMIPKYATAE
IRRHLANATTDLMKLDHEEEPQLSEPYLSKQKKLMAKILEHDDVSYLKKILGELAMVLDQ
IEAELEKRKLENEGQKCELWLCGCAFTLADVLLGATLHRLKFLGLSKKYWEDGSRPNLQS
FFERVQRRFAFRKVLGDIHTTLLSAVIPNAFRLVKRKPPSFFGASFLMGSLGGMGYFAYW
YLKKKYI
Download sequence
Identical sequences A0A2J8XW14 G3QLC5 H2R8Y1 Q96MZ0
ENSPTRP00000052132 9598.ENSPTRP00000052132 9606.ENSP00000341782 ENSP00000341782 ENSGGOP00000003274 GO.36449 NP_076939.3.87134 NP_076939.3.92137 XP_001151420.1.37143 XP_003825967.1.60992 XP_004062236.1.27298 gi|30581160|ref|NP_076939.3| ENSPTRP00000052132 ENSP00000341782 ENSGGOP00000003274 ENSP00000341782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]