SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8Y1X3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8Y1X3
Domain Number 1 Region: 2-104
Classification Level Classification E-value
Superfamily Sec7 domain 7.33e-39
Family Sec7 domain 0.00000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J8Y1X3
Sequence length 104
Comment (tr|A0A2J8Y1X3|A0A2J8Y1X3_PONAB) CYTH1 isoform 16 {ECO:0000313|EMBL:PNJ88274.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0021521 OC=Catarrhini; Hominidae; Pongo.
Sequence
MQRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGER
DEFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDR
Download sequence
Identical sequences A0A1D5R802 A0A2J8K7X9 A0A2J8Y1X3 K7EKA2
ENSP00000465530 ENSP00000465530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]