SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K1IV98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K1IV98
Domain Number 1 Region: 25-126
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.49e-30
Family Chaperone J-domain 0.0002
Further Details:      
 
Domain Number 2 Region: 236-348
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.63e-16
Family PDI-like 0.013
Further Details:      
 
Weak hits

Sequence:  A0A2K1IV98
Domain Number - Region: 347-430
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0372
Family Thioltransferase 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K1IV98
Sequence length 603
Comment (tr|A0A2K1IV98|A0A2K1IV98_PHYPA) Uncharacterized protein {ECO:0000313|EMBL:PNR33188.1} OX=3218 OS=Physcomitrella patens subsp. patens (Moss). GN=PHYPA_025131 OC=Physcomitrella.
Sequence
MASTSPVNLRLFVYFLLLIVVAVDAKKDLYKVLGVDKNASDREIKKAFHKQSLKYHPDKN
KAKNAQSKFEEISHAYEILSDADKRKQYDLVGDETGHGFGGANFGGQYGGQQFQSDGPFF
QSGGPGGRTFTFTFGGPNQGGGDDHGFSQFFGNSQSGRQSRQKQNNKRQAGAQSGWAKNI
YDKFAGNGDGDSGFGNFGNFANFGGGMFDNLFSSFTGGGGEPKQGENISRKTVNVPKGVE
KIGPKKFKTQVLGTEKVSWVILYYMPDSPGISDKLKALAYFAEEMKGIVKVGAVDCDSQD
KFCKEQEIQQFPKLLIYPLRAGGRAKPVPYNGDWTIKAVKKFINQQFSPFTITLTHENFV
EVMSKDQERPLAILVRKTKDHPVSWVALCAEFEKRVDCYDTKVTSDEDPLAKKLGVKEFP
EVVGLLPNGDRLHPDGRVFDESLPKTVGSLRTFLEKLEKNQDLESNEPNAVPVPHLTKTN
MKKVCGPDSSLCIIAASKSSKGEEKSKRILTEISQKSLVRKSHGKGQPVSYSLVDAAKRK
TFMKAFSAVDLSSIDTVLVAYKPRRGRSALYRGPLTLEGVEDFVTKALVGDVTFEPVYET
PTL
Download sequence
Identical sequences A0A2K1IV98
PP1S368_19V6.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]