SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K3PZF6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K3PZF6
Domain Number 1 Region: 5-96
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.12e-28
Family PHBH-like 0.00041
Further Details:      
 
Domain Number 2 Region: 90-178
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000173
Family FAD-linked reductases, N-terminal domain 0.00027
Further Details:      
 
Domain Number 3 Region: 221-421
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000215
Family Glutathione peroxidase-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K3PZF6
Sequence length 427
Comment (tr|A0A2K3PZF6|A0A2K3PZF6_9HYPO) Phenol 2-monooxygenase {ECO:0000313|EMBL:PNY20669.1} OX=45235 OS=Tolypocladium capitatum. GN=TCAP_07364 OC=Tolypocladium.
Sequence
MSQAAIWGVLDGELITDFPDIWSKTLVYSEEHGSILIIPRERNMTRFYIELKACAGTERR
APGQTFVMQQARNIMAPFSIDWKYIEWFGRYQVGQRVASRFADAKTRVFLSGDASHTHSP
KAAQGMNTSMHDSWNLSWKLNLAVRGLAKPDFLESYEEERRKIALDLVNFDYEHANQIAG
GDAVALAQNFKANVRFISGIGAEYGASPLNKEDPADVSFMAGYARPGCLLPPAKVTRYID
SNPVDVQLDIPMLGQFRIFLLMWDVQQAAPFLATFCHAIADHDAFVSKLSAAASASYAAQ
PRLGSAEDVYIRPERYTAVSHLFTFALITTMAKAEMEVSDLPAMLQDSRWTIYLDDVPEQ
DTRGQLCTDKWLGSLEPGEVAIINVRPDGYVGSVGRWNSNVDDSGVDAARWLDEYYAGFM
QIPPSKK
Download sequence
Identical sequences A0A2K3PZF6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]