SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K3TT66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K3TT66
Domain Number 1 Region: 6-153
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000628
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K3TT66
Sequence length 164
Comment (tr|A0A2K3TT66|A0A2K3TT66_ECOLX) SMI1/KNR4 family protein {ECO:0000313|EMBL:PNY67485.1} OX=562 OS=Escherichia coli. GN=C2M16_12980 OC=Enterobacteriaceae; Escherichia.
Sequence
MEKIFQLLETAWPAVKATGLTGCVTAPETEDNLLLFEDKYATHIPKDYRQLLSHFGACHF
ADPQIYTLNDLDRYYPLFFQQWEEYKKEYPSLNNIDPFPVGSFGDGSVAFLDRNSLKIYI
LIHDFGIFTDDVGDFPCELCFENFGELVEMQVEMILYLQQYHVS
Download sequence
Identical sequences A0A062YEI9 A0A2K3TT66
WP_032302975.1.93768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]