SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K4KNR3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K4KNR3
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.24e-46
Family SMI1/KNR4-like 0.000000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K4KNR3
Sequence length 135
Comment (tr|A0A2K4KNR3|A0A2K4KNR3_9PSED) SMI1/KNR4 family protein {ECO:0000313|EMBL:POA74244.1} OX=2075553 OS=Pseudomonas sp. GW531-T4. GN=C1888_06260 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MEEVIEQLREANEPVPVPLELPDEDLLVEIEEQLFINIPFVFKEFLLTVSDVVYGSLEPV
TVTDPQSHTYLPEVAATAWDMGVPRELIPICQDGDDYYCVEEDGTVVLWSGEEELITEES
WESVWHWARDVWLES
Download sequence
Identical sequences A0A0C5EHP5 A0A0D5XRP2 A0A0D6BS85 A0A1H3L7K8 A0A1H4UWD1 A0A1I9FZD0 A0A1Y1TLW6 A0A2K4KNR3 J3E941
WP_007927598.1.10892 WP_007927598.1.14189 WP_007927598.1.19814 WP_007927598.1.2609 WP_007927598.1.26422 WP_007927598.1.28534 WP_007927598.1.29261 WP_007927598.1.29320 WP_007927598.1.34267 WP_007927598.1.36447 WP_007927598.1.36828 WP_007927598.1.39788 WP_007927598.1.41007 WP_007927598.1.41423 WP_007927598.1.41557 WP_007927598.1.47602 WP_007927598.1.52566 WP_007927598.1.58795 WP_007927598.1.61059 WP_007927598.1.61205 WP_007927598.1.70875 WP_007927598.1.74391 WP_007927598.1.75875 WP_007927598.1.76993 WP_007927598.1.90798 WP_007927598.1.90826 WP_007927598.1.93546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]