SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K4W1Y0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K4W1Y0
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.27e-46
Family SMI1/KNR4-like 0.0000000997
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K4W1Y0
Sequence length 135
Comment (tr|A0A2K4W1Y0|A0A2K4W1Y0_PSESX) Cell wall assembly protein {ECO:0000313|EMBL:SOS29899.1} OX=663959 OS=Pseudomonas syringae pv. avii. GN=CFBP3846_05538 OC=Pseudomonadaceae; Pseudomonas; Pseudomonas syringae.
Sequence
MEEVIEQLREANEPVPVPLELPDEDQLVEIEEQLFINIPFVFKEFLLTVSDVVYGSLEPV
TVTDPQSHTYLPEVCATAWDLGVPRELIPICQDGEDYYCVEEDGTVLLWSAEEELVTEES
WESVWHWARDVWLES
Download sequence
Identical sequences A0A099SU12 A0A0N0G0W1 A0A0P9NCK2 A0A0P9PJX6 A0A1H3SNH8 A0A2K4U4P6 A0A2K4W1Y0 F3IL33 Q87TZ9
223283.PSPTO_5518 gi|28872623|ref|NP_795242.1| NP_795242.1.37326 WP_005768316.1.11497 WP_005768316.1.12126 WP_005768316.1.14276 WP_005768316.1.14773 WP_005768316.1.14805 WP_005768316.1.14933 WP_005768316.1.17870 WP_005768316.1.26792 WP_005768316.1.28009 WP_005768316.1.29949 WP_005768316.1.41250 WP_005768316.1.45653 WP_005768316.1.49996 WP_005768316.1.52448 WP_005768316.1.58347 WP_005768316.1.60779 WP_005768316.1.60793 WP_005768316.1.62491 WP_005768316.1.64333 WP_005768316.1.6959 WP_005768316.1.69804 WP_005768316.1.71514 WP_005768316.1.7265 WP_005768316.1.80269 WP_005768316.1.83999 WP_005768316.1.87092 WP_005768316.1.87724 WP_005768316.1.92774 WP_005768316.1.99297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]