SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K4ZZL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K4ZZL6
Domain Number 1 Region: 45-355
Classification Level Classification E-value
Superfamily Pectin lyase-like 4.58e-109
Family Galacturonase 0.000000000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K4ZZL6
Sequence length 362
Comment (tr|A0A2K4ZZL6|A0A2K4ZZL6_ASPNG) Uncharacterized protein {ECO:0000313|EMBL:SPB45227.1} OX=5061 OS=Aspergillus niger. GN=ATCC64974_28680 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MHSFASLLAYGLVAGATFASASPIEARDSCTFTTAAAAKAGKAKCSTITLNNIEVPAGTT
LDLTGLTSGTKVIFEGTTTFQYEEWAGPLISMSGEHITVTGASGHLINCDGARWWDGKGT
SGKKKPKFFYAHGLDSSSITGLNIKNTPLMAFSVQANDITFTDVTINNADGDTQGGHNTD
AFDVGNSVGVNIIKPWVHNQDDCLAVNSGENIWFTGGTCIGGHGLSIGSVGDRSNNVVKN
VTIEHSTVSNSENAVRIKTISGATGSVSEITYSNIVMSGISDYGVVIQQDYEDGKPTGKP
TNGVTIQDVKLESVTGSVDSGATEIYLLCGSGSCSDWTWDDVKVTGGKKSTACKNFPSVA
SC
Download sequence
Identical sequences A0A2K4ZZL6 A2R5S4 P26214
1czf_A 1czf_B 1czfA XP_001397067.1.80561 CADANGAP00011984 e_gw1_6.364.1 5061.CADANGAP00011984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]