SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5C0E9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5C0E9
Domain Number 1 Region: 48-162
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 6.67e-43
Family Frizzled cysteine-rich domain 0.00000913
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5C0E9
Sequence length 574
Comment (tr|A0A2K5C0E9|A0A2K5C0E9_AOTNA) Frizzled class receptor 7 {ECO:0000313|Ensembl:ENSANAP00000002162} KW=Complete proteome OX=37293 OS=Aotus nancymaae (Ma's night monkey). GN=FZD7 OC=Platyrrhini; Aotidae; Aotus.
Sequence
MRGPGAAASRSPLGLCALVLTLLGALSAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDI
AYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPC
RSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYP
TAPYLPDLPYTALPPGAADGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRAN
GLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVA
VAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLT
WFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDA
LRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTV
PATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIV
GITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
Download sequence
Identical sequences A0A2K5C0E9 F7I3D1
ENSCJAP00000008985 ENSCJAP00000008985 XP_008997472.2.60252 XP_012301766.1.9421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]