SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5D3J4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5D3J4
Domain Number 1 Region: 67-128
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000196
Family HLH, helix-loop-helix DNA-binding domain 0.0037
Further Details:      
 
Weak hits

Sequence:  A0A2K5D3J4
Domain Number - Region: 24-76
Classification Level Classification E-value
Superfamily Tryptophan synthase beta subunit-like PLP-dependent enzymes 0.0691
Family Tryptophan synthase beta subunit-like PLP-dependent enzymes 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5D3J4
Sequence length 161
Comment (tr|A0A2K5D3J4|A0A2K5D3J4_AOTNA) Inhibitor of DNA binding 4, HLH protein {ECO:0000313|Ensembl:ENSANAP00000015524} KW=Complete proteome OX=37293 OS=Aotus nancymaae (Ma's night monkey). GN=ID4 OC=Platyrrhini; Aotidae; Aotus.
Sequence
MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEP
ALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPP
PAPPHHPAGTCPAAPPRTPLTALNTDPAGAVNKQGDSILCR
Download sequence
Identical sequences A0A096NL72 A0A0D9R5P5 A0A250XVE5 A0A2K5D3J4 A0A2K5N4N5 A0A2K5QLE6 A0A2K6ECM8 A0A2K6FJJ1 C8ZLJ3 F7GTT4 H0XZ84 K7ASY9 K7ETH0 P47928 U3BTK2
GO.78736 HR4584 ENSPPYP00000023841 ENSOGAP00000021427 ENSP00000367972 ENSOGAP00000021427 ENSPANP00000013730 ENSMMUP00000019275 NP_001252585.1.72884 NP_001537.1.87134 NP_001537.1.92137 XP_002816514.1.23681 XP_003788377.1.62490 XP_004406100.1.74151 XP_005665669.2.46622 XP_007971773.1.81039 XP_011740948.1.29376 XP_011886803.1.92194 XP_012494129.1.63892 XP_012609152.1.48125 XP_012659694.1.62490 XP_016810464.1.37143 XP_017399581.1.71028 XP_017826355.1.60252 XP_019275565.1.44245 XP_019800770.1.83887 XP_020035437.1.5219 XP_021521013.1.9421 XP_021552579.1.83697 XP_021552580.1.83697 ENSPPYP00000023841 ENSP00000367972 9544.ENSMMUP00000019275 9600.ENSPPYP00000018191 9606.ENSP00000367972 ENSP00000367972 gi|4504573|ref|NP_001537.1| ENSMMUP00000019275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]