SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5DC50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5DC50
Domain Number 1 Region: 1124-1300
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.34e-41
Family BCR-homology GTPase activation domain (BH-domain) 0.00059
Further Details:      
 
Domain Number 2 Region: 686-801
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.01e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.0015
Further Details:      
 
Domain Number 3 Region: 878-1039
Classification Level Classification E-value
Superfamily PH domain-like 3.94e-24
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 4 Region: 451-573
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-24
Family Pleckstrin-homology domain (PH domain) 0.0000115
Further Details:      
 
Domain Number 5 Region: 1434-1569
Classification Level Classification E-value
Superfamily PH domain-like 2.39e-20
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 6 Region: 5-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.72e-17
Family SAM (sterile alpha motif) domain 0.000033
Further Details:      
 
Domain Number 7 Region: 587-701
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000175
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number 8 Region: 1017-1116
Classification Level Classification E-value
Superfamily PH domain-like 0.000000113
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5DC50
Sequence length 1704
Comment (tr|A0A2K5DC50|A0A2K5DC50_AOTNA) Uncharacterized protein {ECO:0000313|Ensembl:ENSANAP00000018542} KW=Complete proteome OX=37293 OS=Aotus nancymaae (Ma's night monkey). GN= OC=Platyrrhini; Aotidae; Aotus.
Sequence
MSSVSEVNVDIKDFLMSINLEQYLLCFHESGFTTVKDCAAINDSLLQKIGISPTGHRRRI
LKQLQILLSKMQDIPIYANVHKTKKNNDPSKDHHVPSSDQNICIEISDSSSVQTPSPSQL
GTVTKNLEENDANVERSQYPPSDDKLSLPKHDFPTSEEPHLNLGSLNDYLFGSENIKIES
LITKKTVDHTNEEQRTEKVNLISENLSKLPNADSECLSSVGCSTSETNSGNGTNGLLGGS
PPSPFFQFQGEMIVNDLYVPSSPILAPMRSRSKLVSRPSRSFLLRHRPVPEIPGSTKGIS
GSYFRERRNVATSTEKSAAWQNSNEENSSSIFPYGETFLFQRLENSKKRSIENEFWTQKE
RLKGEATTATNSFIIKSSIYDNRKEKISEDKVEDIWIPREDKNNFLIDTPSESEYSTVEE
CFQSLRRKNSKASKSRPQKALTLDSVNRHSYPLSSTSGNADSSAISSQAISPYACFYGAS
AKKVKSGWLDKLSPQGKRMFQKRWVKFDGLSISYYNNEKEMYSKGIIPLSAVSTVRVQGD
NKFEVVTTQRTFVFRVEKEEERNDWISILLNALKSQSLTSQSQAVVTPEKCGYLELRGYK
AKIFTVLSGNSVWLCKNEQDFKSGLGITVIPMNVANVKQVDRTAKQSFEIITPYRSFSFT
AETEKEKQDWIEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVIC
KKCAGQHRSLGPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLQKDEELHMD
SPVEKRKNFITQKYKEGKFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVMC
ATGDPVHSTPYLLAKKAGQSLQMEFLYHNKFSDFPKHDIHSEGVLSQESSQSTFLCDFLY
QAASAASKLSSEKKLLEETNKKWCVLEGGFLSYYENDKSTTPNGTISINEVICLAIHKED
FYLNTGPIFIFEIYLPSERVFLFGAETCQAQRKWTEAIAKHFVPLFAENLTEADYDLIGQ
LFYKDCHALDQWRKGWFAMDKSSLHFCLQMQEAQEDRMHLRRLQELTISTMVQNGEKLDV
LLLVEKGRTLYIHGHTKLDFTVWHTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFVT
QYGLGCKYIYQKNGDPLHISELLESFKKDARSFKLRAGKHQLEDVTGVLKSFLSDIDDAL
LTKELYPYWISALDTQDDKERIKKYGAFIHTLPGVNRATLAAIIEHLYRVQKCSEINHMN
AHNLALVFSSCLFQTKGQTSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKDT
QVSQAGDLLIEVYVERKEPDCSIIIRISPVMEAEEFTNDILAIKNIIPTKGDIWATFEVI
ENEELERPLHYKENVLEQVLRWSSLAEPGSAYLVVKRFLTADTIKHCSDRSALGSIKEGI
LKIKEEPSKILSGNKFQDRYFVLRDGFLFLYKDAKSSKHEKMFSLSSVKFYRGVKKKMKP
PTSWGLTAYSEKHHWHLCCDSSQTQMEWMTSIFVAQHENDIWPPAGKERKRSITKNPKIG
GLPLIPIQHETNATLARRNIESARAELERLRLSEKRDKEAVDSSLKERASIVAHCLEHKD
DKLRSRTRKHRSFNCLEDTEPEAPLGQQKGHKGLKTLRKADDRNSKATLDSDHKLPSRVI
EELSVVLQRSRTLPKELQDEQILP
Download sequence
Identical sequences A0A2K5DC50
XP_012330388.1.9421 XP_012330389.1.9421 XP_012330390.1.9421 XP_012330391.1.9421 XP_012330392.1.9421 XP_021531322.1.9421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]