SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5DFL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5DFL8
Domain Number 1 Region: 13-90
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.04e-21
Family HLH, helix-loop-helix DNA-binding domain 0.00000739
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5DFL8
Sequence length 121
Comment (tr|A0A2K5DFL8|A0A2K5DFL8_AOTNA) Uncharacterized protein {ECO:0000313|Ensembl:ENSANAP00000019748} KW=Complete proteome OX=37293 OS=Aotus nancymaae (Ma's night monkey). GN= OC=Platyrrhini; Aotidae; Aotus.
Sequence
MSDNDDIEVESDADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATE
YIQYMRRKNHTHQQDIDDLKRQNALLEQQGALPAVGITPGIRCLKRALRSLEWNVLWESE
S
Download sequence
Identical sequences A0A2I3HXF3 A0A2I3S6P6 A0A2K5DFL8 A0A2K6QVX7 G3V563
ENSP00000452197 ENSP00000452197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]