SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5F0T9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5F0T9
Domain Number 1 Region: 427-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.42e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 483-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.22e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 175-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.23e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 539-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 371-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-22
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 231-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-21
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 7 Region: 290-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-20
Family KRAB domain (Kruppel-associated box) 0.00044
Further Details:      
 
Domain Number 9 Region: 137-189
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.8e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 585-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-17
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 11 Region: 87-148
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000404
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 12 Region: 334-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000299
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5F0T9
Sequence length 640
Comment (tr|A0A2K5F0T9|A0A2K5F0T9_AOTNA) Uncharacterized protein {ECO:0000313|Ensembl:ENSANAP00000039030} KW=Complete proteome OX=37293 OS=Aotus nancymaae (Ma's night monkey). GN= OC=Platyrrhini; Aotidae; Aotus.
Sequence
DSVVFEDVAVNFTQEEWALLGPSQKKLYRDVMQETFVNLASIGENWEDKNIEDHRNQGRK
LRSHMVERLCERKEGNQLGEAISQTPNPKTNRKTFTRVKPYECSVCGKDYMCHSSLNRHM
RSHSEHRSYEYQKYGEKSYECKECGKRFSFRSSFRIHERTHTGEKPYKCKQCGKAFSWPS
SFQIHERTHTGEKPYECKECGKAFIYHTTFRGHMRMHTGEKPYKCKECGKTFSHPSSFRN
HERTHSGEKPYECKQCGKAFRYYQTFQIHERTHTGEKPYQCKQCGKALSCPTSFRSHERI
HTGEKPYKCKKCGKAFSFPSSFRKHERIHTGEKPYDCKECGKAFISLPSYRRHMIMHTGN
GPYKCKECGKAFDCPSSFQIHERTHTGEKPYECKQCGKAFSCSSSFRMHERTHTGEKPHE
CKQCGKAFSCSSSVRIHERTHTGEKPYECKQCGKAFSCSSSFRMHERIHTGEKPYECKQC
GKAFSFSSSFRMHERTHTGEKPYECKQCGKAFSCSSSFRMHERTHTGEKPYECKQCGKAF
SCSSSIRIHERTHTGEKPYECKQCGKAFSCSSSVRMHERTHTGVKPYECKQCDKAFSCSR
SFRIHERTHTGEKPYACQQCGKAFKCSRSFRVHERVHTGE
Download sequence
Identical sequences A0A2K5F0T9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]