SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5IH05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5IH05
Domain Number 1 Region: 129-203
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 2.62e-30
Family AN1-like Zinc finger 0.0000737
Further Details:      
 
Domain Number 2 Region: 13-63
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000138
Family A20-like zinc finger 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5IH05
Sequence length 208
Comment (tr|A0A2K5IH05|A0A2K5IH05_COLAP) Fumarylacetoacetate hydrolase {ECO:0000313|Ensembl:ENSCANP00000015831} KW=Complete proteome; Reference proteome OX=336983 OS=Colobus angolensis palliatus (Peters' Angolan colobus). GN=FAH OC=Catarrhini; Cercopithecidae; Colobinae; Colobus.
Sequence
MAQETNHSQVPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPATSVSSLSE
SLPVQCTDGSVPEAQSTLDSTSSSMQPSSVSNQSLLSESVASSQLDSTSVDKAVPETEDL
QASVSDTAQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHN
CSYNYKADAAEKIRKENPVVVGEKIQKI
Download sequence
Identical sequences A0A0D9RRC6 A0A2K5IH05 A0A2K5NFX0 A0A2K6C2M6 A0A2K6MXX5 A0A2K6NMZ4 G7P9A0 H9FW22
NP_001181364.1.72884 XP_002804956.1.72884 XP_002804957.1.72884 XP_002804958.1.72884 XP_008013865.1.81039 XP_008013867.1.81039 XP_008013868.1.81039 XP_008013869.1.81039 XP_008013870.1.81039 XP_010381600.1.97406 XP_010381601.1.97406 XP_010381602.1.97406 XP_011758853.1.29376 XP_011758854.1.29376 XP_011758855.1.29376 XP_011758856.1.29376 XP_011758858.1.29376 XP_011758859.1.29376 XP_011793769.1.43180 XP_011793771.1.43180 XP_011793772.1.43180 XP_011793773.1.43180 XP_011793774.1.43180 XP_011884763.1.92194 XP_011884767.1.92194 XP_011884778.1.92194 XP_011884789.1.92194 XP_011884800.1.92194 XP_011884810.1.92194 XP_011884819.1.92194 XP_014998335.1.72884 XP_014998336.1.72884 XP_014998337.1.72884 XP_015307931.1.63531 XP_015307932.1.63531 XP_015307933.1.63531 XP_015307934.1.63531 XP_015307935.1.63531 XP_015307936.1.63531 XP_015307937.1.63531 XP_017742314.1.44346 XP_017742315.1.44346 XP_017742316.1.44346 XP_017742317.1.44346 XP_017742318.1.44346 9544.ENSMMUP00000033358 ENSMMUP00000012257 ENSMMUP00000033358 ENSMMUP00000033359 ENSMMUP00000012257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]