SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5IS10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5IS10
Domain Number 1 Region: 431-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.1e-24
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 2 Region: 487-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.37e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 319-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.91e-23
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-22
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 5 Region: 375-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-21
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 6 Region: 262-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-19
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 7 Region: 532-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.34e-19
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 8 Region: 130-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000492
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5IS10
Sequence length 634
Comment (tr|A0A2K5IS10|A0A2K5IS10_COLAP) Zinc finger protein 792 {ECO:0000313|Ensembl:ENSCANP00000019267} KW=Complete proteome; Reference proteome OX=336983 OS=Colobus angolensis palliatus (Peters' Angolan colobus). GN=ZNF792 OC=Catarrhini; Cercopithecidae; Colobinae; Colobus.
Sequence
MAEAALRDPAQGCVTFEDVTIYFSQEEWGLLDEAQRLLYCDVMLENFALIASLGLISFRS
HIVSQLEMGKEPWVPDSVDMTSAMARGAYGRPGSDFCRGTEGKDLPSEHNVSVEGVAQDR
SPQATLCPQKTCPCDICGLRLKDILHLAEHQTTHPRQKPFLCEAYVKGCEFRANLPQKQV
QQNVHNPIRREEGQALPIKTWGDHTSDQLSTCREGGEDFVATAGFLQREVTPSDGEPHKA
TESVVDFHIALRHNKCCDSGDAFNDKSTLVQHQRIHSRERPYECSKCGIFFTYAADLTQH
QKVHNRGKPYECCECGKFFSQHSSLVKHRRVHTGESPHVCGDCGKFFSRSSNLIQHKRVH
TGEKPYECSDCGKFFSQRSNLIHHKRVHTGRSAHECSECGKSFNCNSSLIKHWRVHTGER
PYKCNECGKFFSHIASLIQHQIVHTGERPHGCGECGKAFSRSSDLMKHQRVHTGERPYEC
NECGKLFSQSSSLNSHRRLHTGERPYQCSECGKFFNQSSSLHNHRRLHTGERPYECSECG
KTFRQRSNLRQHLKVHKPDRPYECSECGKAFNQRPTLIRHQKIHTRERSMENVLLPCSMQ
QHTPEISSENRPYEGAVNYKLNLVHPSTHPGEVP
Download sequence
Identical sequences A0A2K5IS10
XP_011803011.1.43180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]