SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5JJ11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5JJ11
Domain Number 1 Region: 1122-1298
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.91e-41
Family BCR-homology GTPase activation domain (BH-domain) 0.00072
Further Details:      
 
Domain Number 2 Region: 684-799
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.01e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.0015
Further Details:      
 
Domain Number 3 Region: 876-1037
Classification Level Classification E-value
Superfamily PH domain-like 3.94e-24
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 4 Region: 449-571
Classification Level Classification E-value
Superfamily PH domain-like 4.62e-24
Family Pleckstrin-homology domain (PH domain) 0.0000113
Further Details:      
 
Domain Number 5 Region: 1432-1569
Classification Level Classification E-value
Superfamily PH domain-like 1.75e-19
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number 6 Region: 5-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.3e-17
Family SAM (sterile alpha motif) domain 0.0000274
Further Details:      
 
Domain Number 7 Region: 585-683
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000308
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 8 Region: 1014-1108
Classification Level Classification E-value
Superfamily PH domain-like 0.000000225
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5JJ11
Sequence length 1702
Comment (tr|A0A2K5JJ11|A0A2K5JJ11_COLAP) ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2 {ECO:0000313|Ensembl:ENSCANP00000028845} KW=Complete proteome; Reference proteome OX=336983 OS=Colobus angolensis palliatus (Peters' Angolan colobus). GN=ARAP2 OC=Catarrhini; Cercopithecidae; Colobinae; Colobus.
Sequence
MSSVSEVNVDIKDFLMSINLEQYLLHFHESGFTTVKDCAAINDSLLQKIGISPTGHRRRI
LKQLQIILSKMQDFPIYANVHKTKKNDDPSKDHSVPSSDQNICMELSSSSSVQTPSPPQL
ETVTKKLEDDASVERNQYPQSDNKLSPPKRDFPTAEEPHLNLGSLNDSLFGSENIKIESL
ITKKTMDHIIEEQQTEKVKLISENLSKLPNADSECLSSVGCSTSETNSGNGTNGLLDGSP
PSPFFKFQGEMIVNDLYVPSSPILAPMRSRSKLVSRPSRSFLLRHRPVPEIPGSTKGISG
SYFRERRNVATSTDKSVAWQNSNEENSSSIFPYGETFLFQRLENSKKRSIKNEFLTQEEA
LKKEATTETNSFIIKSSIYDNRKKISEDKVEDIWIPREDKNNFLVDTASESEYSTVEECF
QSLRRKNSKASKSRTQKALTLDSVNRHSYPLSSTSGNADSSAVSSQAISPYACFYGASVK
KVKSGWLDKLSPQGKRMFQKRWVKFDGLSISYYNNEKEMYSKGIIPLSAISTVRVQGDNK
FEVVTTQRTFVFRVEKEEERNDWISILLNALKSQSLTSQSQGVVTPEKYGYLELRGYKAK
IFTVLSGNSVWLCKNEQDFKSGLGITIIPMNVANVKQVDRTVKQSFEIITPYRSFSFTAE
TEKEKQDWIEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICKK
CAGQHRSLGPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLQKDEELHMDSP
VEKRKNFITQKYKEGKFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVMCAT
GDPVHSTPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIHSEGVLSQESSQSTFLCDFLYQA
PSAASKLSSEKKLLEETNKKWCVLEGGFLSYYESDKSTTPNGTININEVICLAIHKEDFY
LNTGPIFIFEIYLPSDRVFLFGAETSQAQRKWTEAIAKHFVPLFAENLTEADYDLIGQLF
YKDCHALDQWRKGWFAMDKSSLHFCLQMQEVQGDRMHLRRLQELTISTMVQNGEKLDVLL
LVEKGRTLYIHGHTKLDFTVWHTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFVTQY
GLGCKYIYQKNGDPLRVSELLESFKKDARSFKLRAGKHQLEDVTGVLKSFLSDIDDALLT
KELYPYWISALDTQDDKERIKKYGAFIRSLPGVNRATLAAIIEHLYRVQKCSEINHMNAH
NLALVFSSCLFQTKGQTSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKDTQV
SQAGDLLIEVYVERKEPDCSIIIRISPVMEAEELTNDILAIKNIIPTKGDIWATFEVIEN
EELERPLHYKENVLEQVLRWSSLAEPGSAYLVVKKFLTADTIKHCSDRSTLGSIKEGILK
IKEEPSKILSGNKFQDRYFVLRDGFLLLYKDVKSSKHDKMFSLSSVKFYRGVKKKMKPPT
SWGLTAYSEKHHWHLCCDSSQTQTEWMTSIFIAQHENDIWPPAGKERKRSITKNPKIGGL
PLIPIQHEGNATLARKNIESARAELERLRLIEKCDKESVDSSLKERASMVAHCLEHKDDK
LRNRTRKHRSFNCLEDTEPEAPLGQPKGHKGLKTLRKTEDRNSKATLDSDHKLPSRVIEE
LNVVLQRSRTLPRELQDEQILK
Download sequence
Identical sequences A0A2K5JJ11
XP_011804530.1.43180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]