SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5JQ93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5JQ93
Domain Number 1 Region: 38-97
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000759
Family HLH, helix-loop-helix DNA-binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5JQ93
Sequence length 134
Comment (tr|A0A2K5JQ93|A0A2K5JQ93_COLAP) Inhibitor of DNA binding 2 {ECO:0000313|Ensembl:ENSCANP00000031021} KW=Complete proteome; Reference proteome OX=336983 OS=Colobus angolensis palliatus (Peters' Angolan colobus). GN=ID2 OC=Catarrhini; Cercopithecidae; Colobinae; Colobus.
Sequence
MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVS
KMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEF
PSELMSNDSKALCG
Download sequence
Identical sequences A0A0D9R3Z9 A0A2I3MZ97 A0A2J8V3T9 A0A2K5JQ93 A0A2K5LGT6 A0A2K5S0G5 A0A2K5ZYW0 A0A2K6D7B0 A0A2K6N4P3 A0A2K6NAG8 F7DNR9 G1RRW6 H0X780 I3NB28 K7B2V9 Q02363 Q4R5J7 Q53T66 Q5RCH7
ENSP00000234091 gi|31982933|ref|NP_002157.2| GO.78734 HR2921 hss001000906.1 ENSNLEP00000015985 NP_001125282.1.23681 NP_002157.2.87134 NP_002157.2.92137 XP_003272760.1.23891 XP_003308921.2.37143 XP_003787424.1.62490 XP_005327402.1.77405 XP_005327403.1.77405 XP_008591780.1.73410 XP_015335488.1.40921 XP_015335489.1.40921 XP_017380512.1.71028 ENSOGAP00000011256 ENSNLEP00000015985 9544.ENSMMUP00000004318 9600.ENSPPYP00000014197 9606.ENSP00000234091 ENSOGAP00000011256 ENSP00000234091 ENSP00000379585 ENSP00000385465 ENSMMUP00000004318 ENSPPYP00000014197 ENSSTOP00000021575 ENSSTOP00000021575 ENSP00000234091 ENSP00000379585 ENSP00000385465 ENSPPYP00000014197 ENSMMUP00000004318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]