SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5K283 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5K283
Domain Number 1 Region: 9-306
Classification Level Classification E-value
Superfamily Aldolase 2.2e-70
Family Class I aldolase 0.000057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5K283
Sequence length 320
Comment (tr|A0A2K5K283|A0A2K5K283_COLAP) N-acetylneuraminate pyruvate lyase {ECO:0000313|Ensembl:ENSCANP00000035218} KW=Complete proteome; Reference proteome OX=336983 OS=Colobus angolensis palliatus (Peters' Angolan colobus). GN=NPL OC=Catarrhini; Cercopithecidae; Colobinae; Colobus.
Sequence
MAFPKKKLQGLVAATITPMTENGEINFSVIGQYVDYLVKEQGVKNIFVNGTTGEGLSLSI
SERRQVAEEWVTKGKDKLDQVVIHVGALSLKESQELAQHAAEIGADGIAVIAPFFLKPWT
KDILINFLKEVAAAAPALPFYYYHIPALTGVKIRAEELLDGIQDKIPTFQGLKFSDTDLL
DFGQCVDQNRQQQFAFLFGVDEQLLSALVMGATGAVGSTYNYLGKKTNQMLEAFERKDLS
LALNYQFCIQRFINFVVKLGFGVSQTKAIMTLVSGIPMGPPRLPLQKASREFTDSAEAKL
KSLDFLSFTDLKDGSLEASS
Download sequence
Identical sequences A0A096NG31 A0A2K5K283 A0A2K5MU34 G7MF42
ENSMMUP00000011775 ENSPANP00000011893 ENSMMUP00000011776 9544.ENSMMUP00000011776 XP_011797501.1.43180 XP_011903575.1.92194 XP_011903583.1.92194 XP_011903591.1.92194 XP_011903601.1.92194 XP_014977734.1.72884 XP_014977740.1.72884 XP_014977748.1.72884 XP_014977756.1.72884 XP_014977761.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]