SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5KW19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5KW19
Domain Number 1 Region: 36-115
Classification Level Classification E-value
Superfamily HMG-box 7.99e-30
Family HMG-box 0.0000071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5KW19
Sequence length 319
Comment (tr|A0A2K5KW19|A0A2K5KW19_CERAT) SRY-box 2 {ECO:0000313|Ensembl:ENSCATP00000004881} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN=SOX2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
MYNMMETELKPPGPQQTSGGGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRK
MAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT
LMKKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQDQL
GYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALG
SMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMSQHY
QSGPVPGTAINGTLPLSHM
Download sequence
Identical sequences A0A0D9SC13 A0A2K5KW19 A0A2K5UL35 A0A2K6B307 A0A2K6NEL0 B8XIA2 G1SBA9 H0Y203 H2PC44 H2R486
ENSMMUP00000000908 ENSPPYP00000016027 ENSNLEP00000022803 NP_001136412.1.72884 XP_002814367.1.23681 XP_003800142.1.62490 XP_005546525.1.63531 XP_007970196.1.81039 XP_010361825.1.97406 XP_011736823.1.29376 XP_011944158.1.92194 XP_012366121.1.23891 XP_014987015.1.72884 XP_014987016.1.72884 XP_516895.4.37143 ENSMMUP00000000908 ENSNLEP00000022803 ENSOGAP00000022396 ENSOGAP00000022396 ENSPPYP00000016027 9544.ENSMMUP00000000908 9600.ENSPPYP00000016027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]