SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5KYM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5KYM0
Domain Number 1 Region: 257-323
Classification Level Classification E-value
Superfamily Homeodomain-like 3.12e-20
Family Homeodomain 0.0023
Further Details:      
 
Domain Number 2 Region: 79-147
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000196
Family LIM domain 0.016
Further Details:      
 
Domain Number 3 Region: 47-78
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000268
Family LIM domain 0.0076
Further Details:      
 
Weak hits

Sequence:  A0A2K5KYM0
Domain Number - Region: 141-173
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00159
Family LIM domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5KYM0
Sequence length 406
Comment (tr|A0A2K5KYM0|A0A2K5KYM0_CERAT) LIM homeobox 2 {ECO:0000313|Ensembl:ENSCATP00000005779} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN=LHX2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
MLFHSLSGPEVHGVIDEMDRRAKSEAPAISSAIDRGDTETTMPSISSDRAALCAGCGGKI
SDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHL
GISASEMVMRARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLHFEALLQGEYPAH
FNHADVAAAAAAAAAAKSAGLGAAGANPLGLPYYNGVGTVQKGRPRKRKSPGPGADLAAY
NAALSCNENDAEHLDRDQPYPSSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLA
QKTGLTKRVLQVWFQNARAKFRRNLLRQENTGVDKSTDTALQTGTPSGPASELSNASLSP
SSTPTTLTDLTSPTLPTVTSVLTSVPGNLEGHEPHSPSQTTLTNLF
Download sequence
Identical sequences A0A096P0M4 A0A0D9RM45 A0A2K5K8Q9 A0A2K5KYM0 A0A2K5ULQ9 A0A2K6D2V7 F6TBF3
ENSPANP00000018899 ENSMMUP00000004894 9544.ENSMMUP00000004894 NP_001248721.1.72884 XP_005580870.1.63531 XP_008004496.1.81039 XP_011709617.1.29376 XP_011786793.1.43180 XP_011894608.1.92194 ENSMMUP00000004894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]