SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5KZN0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5KZN0
Domain Number 1 Region: 75-132
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.96e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5KZN0
Sequence length 133
Comment (tr|A0A2K5KZN0|A0A2K5KZN0_CERAT) Nescient helix-loop-helix 1 {ECO:0000313|Ensembl:ENSCATP00000006149} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN=NHLH1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
MMLNSDTMELDLPPNHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDMQH
LSREERRRRRRATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLA
ICYISYLNHVLDV
Download sequence
Identical sequences A0A096MXA7 A0A0D9SAL5 A0A2K5KZN0 A0A2K5XPJ3 A0A2K6AVI2 F7EHS2 G7NWD2
ENSPANP00000004518 ENSMMUP00000028792 ENSMMUP00000028792 XP_001117555.1.72884 XP_005541312.1.63531 XP_007974681.1.81039 XP_011768381.1.29376 XP_011825765.1.47321 XP_011923017.1.92194 XP_011923018.1.92194 9544.ENSMMUP00000028792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]