SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5L0Q7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5L0Q7
Domain Number 1 Region: 10-52
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000102
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5L0Q7
Sequence length 230
Comment (tr|A0A2K5L0Q7|A0A2K5L0Q7_CERAT) Rhophilin associated tail protein 1 like {ECO:0000313|Ensembl:ENSCATP00000006508} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN=ROPN1L OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
MPLPDTMFCAQQIHIPPELPDILKQFTKAAIRTQPADVLQWSAGYFSALSRGDPLPVKDR
MEMPTATQKTDTGLTQGLLKILHKQCHHKQYVELTDLEQKWKNLCLPKEKFKALLQLDPC
ENRIKWINFLALGCSMLGGSLNTALKHLCEILTDDPEGGPARIPFKTFSYVYRYLAKLDS
DVSSSETESYLASLKENIDTRRNGMIGLSDFFFPKRNLLENRENSEDVGH
Download sequence
Identical sequences A0A096MP03 A0A2K5L0Q7
ENSPANP00000001436 XP_011915871.1.92194 XP_011915872.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]